-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against U2AF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against U2AF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-03478A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | U2AF1 |
| Target Synonyms | RN; FP793; U2AF35; U2AFBP; RNU2AF1; U2AF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, K-562, LO2, Mouse spleen, Rat spleen | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN | Uniprot ID | Q01081 |
Uniprot Id
Q01081
Target Species
Human
Target Name
U2AF1
Target Full Name
Splicing factor U2AF 35 kDa subunit
Target Function
Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Recruits U2 snRNP to the branch point. Directly mediates interactions between U2AF2 and proteins bound to the enhancers and thus may function as a bridge between U2AF2 and the enhancer complex to recruit it to the adjacent intron.
Target Involvement
Myelodysplastic syndrome (MDS)
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Protein Families
Splicing factor SR family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DKFZp313J1712; FP793; Human U2 snRNP auxiliary factor small subunit9; RN; RNU2AF1; Splicing factor U2AF 35 kDa subunit; U2 auxiliary factor 35 kDa subunit; U2 small nuclear ribonucleoprotein auxillary factor 35 KD subunit; U2 small nuclear RNA auxiliary factor 1; U2 snRNP auxiliary factor small subunit; U2(RNU2) small nuclear RNA auxiliary factor 1; U2(RNU2) small nuclear RNA auxiliary factor binding protein; U2AF1; U2AF1_HUMAN; U2AF35; U2AFBP
Target Background
This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification