Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human UAP1 (Q16222) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human UAP1 (Q16222) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14181A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UAP1 |
| Target Synonyms | AGX; AGX1; AGX2; SPAG2; UAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, DU-145, HepG2, Jurkat, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human UAP1 (Q16222). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDEFSPLKNADSQNGKDNPTTARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQCEISPLISYAGEGLESYVAD | Uniprot ID | Q16222 |
Uniprot Id
Q16222
Target Species
Human
Target Name
UAP1
Target Full Name
UDP-N-acetylhexosamine pyrophosphorylase
Target Function
Converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.
Target Subcellular Location
Cytoplasm. Note=In spermatozoa, localized to the principal piece of the tail, the neck region of the head and to a lesser extent, the midpiece of the tail.
Target Protein Families
UDPGP type 1 family
Target Tissue Specificity
Widely expressed. Isoform AGX1 is more abundant in testis than isoform AGX2, while isoform AGX2 is more abundant than isoform AGX1 in somatic tissue. Expressed at low level in placenta, muscle and liver.
Target Research Area
Signal Transduction
Target Synonyms
AGX 1; AGX; AGX-1; AGX-2; AGX1; Antigen X; AntigenX; SPAG 2; SPAG2; Sperm associated antigen 2; Sperm-associated antigen 2; UAP 1; uap1; UAP1_HUMAN; UDP N acetylhexosamine pyrophosphorylase; UDP N acteylglucosamine pyrophosphorylase 1; UDP-N-acetylglucosamine pyrophosphorylase
Target Background
Enables identical protein binding activity. Predicted to be involved in UDP-N-acetylglucosamine biosynthetic process. Located in cytosol; nucleoplasm; and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
