Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human UBE2F (NP_542409.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UBE2F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human UBE2F (NP_542409.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08627A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2F |
| Target Synonyms | NCE2; UBE2F | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, K-562, Mouse liver, Mouse pancreas | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human UBE2F (NP_542409.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR | Uniprot ID | Q969M7 |
Uniprot Id
Q969M7
Target Species
Human
Target Name
UBE2F
Target Full Name
NEDD8-conjugating enzyme UBE2F
Target Function
Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.
Target Protein Families
Ubiquitin-conjugating enzyme family, UBE2F subfamily
Target Tissue Specificity
Widely expressed (at protein level).
Target Research Area
others
Target Synonyms
NCE2; NEDD8 carrier protein UBE2F; NEDD8 conjugating enzyme; NEDD8 conjugating enzyme UBE2F; NEDD8 protein ligase UBE2F; NEDD8-conjugating enzyme 2; NEDD8-conjugating enzyme UBE2F; ube2f; UBE2F_HUMAN; Ubiquitin conjugating enzyme E2F; Ubiquitin conjugating enzyme E2F (putative); Ubiquitin-conjugating enzyme E2 F
Target Background
Enables NEDD8 conjugating enzyme activity. Involved in protein neddylation. Predicted to be located in cytosol. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
