-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human UBE2G2 (NP_003334.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UBE2G2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human UBE2G2 (NP_003334.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01480A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2G2 |
| Target Synonyms | UBC7; UBE2G2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, DU145, HT-1080, MCF7, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human UBE2G2 (NP_003334.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL | Uniprot ID | P60604 |
Uniprot Id
P60604
Target Species
Human
Target Name
UBE2G2
Target Full Name
Ubiquitin-conjugating enzyme E2 G2
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD). Required for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase and its subsequent proteasomal degradation.
Target Subcellular Location
Endoplasmic reticulum. Lipid droplet.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
Human ubiquitin conjugating enzyme G29; UB2G2_HUMAN; UBC 7; UBC7; UBC7 homolog yeast; UBE2G2; Ubiquitin carrier protein G2; Ubiquitin conjugating enzyme 7; Ubiquitin conjugating enzyme E2 G2; Ubiquitin conjugating enzyme E2G 2 (homologous to yeast UBC7); Ubiquitin conjugating enzyme E2G 2 (UBC7 homolog yeast); Ubiquitin conjugating enzyme E2G 2 (UBC7 homolog; yeast); Ubiquitin conjugating enzyme E2G 2; Ubiquitin conjugating enzyme G2; Ubiquitin protein ligase G2; Ubiquitin-conjugating enzyme E2 G2; Ubiquitin-protein ligase G2
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification