-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ube2N/Ubc13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ube2N/Ubc13 (P61088) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Ube2N/Ubc13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ube2N/Ubc13 (P61088) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14034A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ube2N/Ubc13 |
| Target Synonyms | UBC13; UbcH13; UBCHBEN; HEL-S-71; UbcH-ben; Ube2N/Ubc13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, 293T, HCT 116, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ube2N/Ubc13 (P61088). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQ | Uniprot ID | P61088 |
Uniprot Id
P61088
Target Species
Human
Target Name
UBE2N
Target Full Name
Ubiquitin-conjugating enzyme E2 N
Target Function
The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production. UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
Bendless like ubiquitin conjugating enzyme; Bendless-like ubiquitin-conjugating enzyme; BLU; EC 6.3.2.19; Epididymis secretory protein Li 71; HEL-S-71; Human epidermoid carcinoma mRNA for ubiquitin-conjugating enzyme E2 similar to Drosophila bendless gene product complete cds; MGC131857; MGC8489; UBC 13; Ubc13; UbCH ben; UbcH-ben; UbcH13; UBCHBEN; Ube 2N; Ube2n; UBE2N_HUMAN; Ubiquitin carrier protein N; Ubiquitin conjugating enzyme E2 N; Ubiquitin conjugating enzyme E2N (homologous to yeast UBC13); Ubiquitin conjugating enzyme E2N (UBC13 homolog yeast); Ubiquitin conjugating enzyme E2N; Ubiquitin protein ligase N; Ubiquitin-conjugating enzyme E2 N; Ubiquitin-protein ligase N; Yeast UBC13 homolog
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
Notification