Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2Q2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UBE2Q2 (NP_775740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2Q2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UBE2Q2 (NP_775740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08887A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2Q2 |
| Target Synonyms | UBE2Q2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HL-60, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UBE2Q2 (NP_775740.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED | Uniprot ID | Q8WVN8 |
Uniprot Id
Q8WVN8
Target Species
Human
Target Name
UBE2Q2
Target Full Name
Ubiquitin-conjugating enzyme E2 Q2
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
LOC92912; UB2Q2_HUMAN; UBE2Q2; Ubiquitin carrier protein Q2; Ubiquitin conjugating enzyme E2Q 2; Ubiquitin conjugating enzyme E2Q family member 2; Ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; Ubiquitin-protein ligase Q2
Target Background
Enables ubiquitin-protein transferase activity. Involved in protein K48-linked ubiquitination. Predicted to be located in cytosol. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
