-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2V1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2V1 (NP_001027459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2V1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2V1 (NP_001027459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2V1 |
| Target Synonyms | CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1; UBE2V1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, BT-474, HepG2, Mouse brain, Mouse pancreas, Mouse spinal cord, Rat liver, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2V1 (NP_001027459.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN | Uniprot ID | Q13404 |
Uniprot Id
Q13404
Target Species
Human
Target Name
UBE2V1
Target Full Name
Ubiquitin-conjugating enzyme E2 variant 1
Target Function
Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production. UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.
Target Subcellular Location
Nucleus. Note=Excluded from the nucleolus.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.
Target Synonyms
CIR1; CROC-1; CROC1; CROC1A; TRAF6-regulated IKK activator 1 beta Uev1A; UB2V1_HUMAN; UBE2V 1; UBE2V; UBE2V1; Ubiquitin conjugating enzyme E2 variant 1; Ubiquitin-conjugating enzyme E2 variant 1; UEV-1; UEV1
Target Background
Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Notification