-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBQLN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 366-432 of human UBQLN4 (NP_064516.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UBQLN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 366-432 of human UBQLN4 (NP_064516.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04779A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBQLN4 |
| Target Synonyms | A1U; A1Up; UBIN; CIP75; C1orf6; UBQLN4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse testis, Mouse thymus, Rat kidney, RD, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 366-432 of human UBQLN4 (NP_064516.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFAAQMMVNVPLFAG | Uniprot ID | Q9NRR5 |
Uniprot Id
Q9NRR5
Target Species
Human
Target Name
UBQLN4
Target Full Name
Ubiquilin-4
Target Function
Regulator of protein degradation that mediates the proteasomal targeting of misfolded, mislocalized or accumulated proteins. Acts by binding polyubiquitin chains of target proteins via its UBA domain and by interacting with subunits of the proteasome via its ubiquitin-like domain. Key regulator of DNA repair that represses homologous recombination repair: in response to DNA damage, recruited to sites of DNA damage following phosphorylation by ATM and acts by binding and removing ubiquitinated MRE11 from damaged chromatin, leading to MRE11 degradation by the proteasome. MRE11 degradation prevents homologous recombination repair, redirecting double-strand break repair toward non-homologous end joining (NHEJ). Specifically recognizes and binds mislocalized transmembrane-containing proteins and targets them to proteasomal degradation. Collaborates with DESI1/POST in the export of ubiquitinated proteins from the nucleus to the cytoplasm. Also plays a role in the regulation of the proteasomal degradation of non-ubiquitinated GJA1. Acts as an adapter protein that recruits UBQLN1 to the autophagy machinery. Mediates the association of UBQLN1 with autophagosomes and the autophagy-related protein LC3 (MAP1LC3A/B/C) and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome. Endoplasmic reticulum. Cytoplasm, perinuclear region. Cytoplasmic vesicle, autophagosome.
Target Tissue Specificity
Highly expressed in pancreas, kidney, skeletal muscle, heart and throughout the brain, and at lower levels in placenta, lung and liver.
Target Synonyms
28S ribosomal protein S7; A1U; A1Up; AI663987; Ataxin 1 interacting ubiquitin like protein; Ataxin 1 ubiquitin like interacting protein A1U; Ataxin 1 ubiquitin like interacting protein; Ataxin-1 ubiquitin-like-interacting protein A1U; bMRP 27a; bMRP27a; C1orf6; CIP75; Connexin43 interacting protein of 75 kDa; MRP S7; RGD1308273; S7mt; UBIN; Ubiquilin 4; Ubiquilin-4; UBQL4_HUMAN; UBQLN4
Target Background
Enables K48-linked polyubiquitin modification-dependent protein binding activity and identical protein binding activity. Involved in cellular response to DNA damage stimulus; negative regulation of double-strand break repair via homologous recombination; and regulation of cellular catabolic process. Located in several cellular components, including autophagosome; nucleoplasm; and site of DNA damage. Part of protein-containing complex. Colocalizes with cytosolic proteasome complex and nuclear proteasome complex.
Notification