-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UCHL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UCHL3 (NP_005993.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UCHL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UCHL3 (NP_005993.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16180A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UCHL3 |
| Target Synonyms | UCH-L3; UCHL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, C2C12, Jurkat, Mouse brain, PC-12, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UCHL3 (NP_005993.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGL | Uniprot ID | P15374 |
Uniprot Id
P15374
Target Species
Human
Target Name
UCHL3
Target Full Name
Ubiquitin carboxyl-terminal hydrolase isozyme L3
Target Function
Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3'', and exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C12 family
Target Tissue Specificity
Highly expressed in heart, skeletal muscle, and testis.
Target Synonyms
Ubiquitin carboxyl-terminal hydrolase isozyme L3; Ubiquitin thioesterase L3; Ubiquitin thiolesterase; Ubiquitin thiolesterase L3; UCH L3; UCH-L3; UCHL3; UCHL3_HUMAN
Target Background
The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Notification