-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UFD1L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UFD1L (Q92890) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UFD1L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UFD1L (Q92890) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13287A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UFD1L |
| Target Synonyms | UFD1L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, K-562, MCF7, Mouse brain, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UFD1L (Q92890). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQ | Uniprot ID | Q92890 |
Uniprot Id
Q92890
Target Species
Human
Target Name
UFD1
Target Full Name
Ubiquitin recognition factor in ER-associated degradation protein 1
Target Function
Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures. Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I.
Target Subcellular Location
Nucleus. Cytoplasm, cytosol.
Target Protein Families
UFD1 family
Target Tissue Specificity
Found in adult heart, skeletal muscle and pancreas, and in fetal liver and kidney.
Target Research Area
Cell Biology
Target Synonyms
UB fusion protein 1; Ubiquitin fusion degradation 1 like (yeast); Ubiquitin fusion degradation 1 like; Ubiquitin fusion degradation protein 1 homolog; UFD1; UFD1_HUMAN; UFD1L
Target Background
The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18.
Notification