Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UFM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-85 of human UFM1 (P61960) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UFM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-85 of human UFM1 (P61960) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13302A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UFM1 |
| Target Synonyms | HLD14; BM-002; C13orf20; UFM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, HL-60, Mouse brain, Mouse pancreas, Mouse spleen, Rat pancreas, Rat spleen, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-85 of human UFM1 (P61960). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC | Uniprot ID | P61960 |
Uniprot Id
P61960
Target Species
Human
Target Name
UFM1
Target Full Name
Ubiquitin-fold modifier 1
Target Function
Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to lysine residues of substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. Ufmylation is involved in reticulophagy (also called ER-phagy) induced in response to endoplasmic reticulum stress. Ufmylation of TRIP4 regulates nuclear receptors-mediated transcription.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
UFM1 family
Target Synonyms
BM 002; BM002; C13orf20; Chromosome 13 open reading frame 20; Ubiquitin fold modifier 1; Ubiquitin-fold modifier 1; UFM1; UFM1_HUMAN
Target Background
UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
