Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UFM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UFM1 (NP_057701.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UFM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UFM1 (NP_057701.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11360A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UFM1 |
| Target Synonyms | HLD14; BM-002; C13orf20; UFM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat pancreas | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UFM1 (NP_057701.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTA | Uniprot ID | P61960 |
Uniprot Id
P61960
Target Species
Human
Target Name
UFM1
Target Full Name
Ubiquitin-fold modifier 1
Target Function
Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to lysine residues of substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. Ufmylation is involved in reticulophagy (also called ER-phagy) induced in response to endoplasmic reticulum stress. Ufmylation of TRIP4 regulates nuclear receptors-mediated transcription.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
UFM1 family
Target Synonyms
BM 002; BM002; C13orf20; Chromosome 13 open reading frame 20; Ubiquitin fold modifier 1; Ubiquitin-fold modifier 1; UFM1; UFM1_HUMAN
Target Background
UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
