-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UGT1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-150 of human UGT1A4 (NP_009051.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UGT1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-150 of human UGT1A4 (NP_009051.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03747A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UGT1A4 |
| Target Synonyms | GNT1; UGT1; UDPGT; UGT1A; UGT1D; UGT-1A; UGT-1D; UGT1.1; UGT1.4; UGT1A1; HUG-BR2; UGT1-01; UGT1-04; UGT1A4S; hUG-BR1; UDPGT 1-4; UGT1A4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, HT-29, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-150 of human UGT1A4 (NP_009051.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRHLNATSFDVVL | Uniprot ID | P22310 |
Uniprot Id
P22310
Target Species
Human
Target Name
UGT1A4
Target Full Name
UDP-glucuronosyltransferase 1A4
Target Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Involved in the glucuronidation of calcidiol, which is the major circulating form of vitamin D3 essential for the regulation of calcium and phosphate homeostasis. Also glucuronidates the biologically active form of vitamin D3, calcitriol, probably leading to its biliary transport and intestinal reabsorption.; Lacks UDP-glucuronosyltransferase (UGT) activity but acts as a negative regulator of isoform 1.
Target Involvement
Gilbert syndrome (GILBS); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
UDP-glycosyltransferase family
Target Tissue Specificity
[Isoform 1]: Expressed in liver. Expressed in kidney, colon and small intestine. Not expressed in esophagus. Not expressed in skin.; [Isoform 2]: Expressed in liver, kidney, colon, esophagus and small intestine.
Target Synonyms
Bilirubin UDP glucuronosyltransferase isozyme 2; Bilirubin-specific UDPGT isozyme 2; HUG-BR2; UD14_HUMAN; UDP glucuronosyltransferase 1 family polypeptide A4; UDP glycosyltransferase 1 family polypeptide A4; UDP-glucuronosyltransferase 1-4; UDP-glucuronosyltransferase 1-D; UDP-glucuronosyltransferase 1A4; UDPGT 1-4; UDPGT; UGT-1D; UGT1*4; UGT1-04; UGT1.4; UGT1A4; UGT1D
Target Background
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.
Notification