Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ULK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ULK2 (NP_001136082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ULK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ULK2 (NP_001136082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05191A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ULK2 |
| Target Synonyms | ATG1B; Unc51.2; ULK2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ULK2 (NP_001136082.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAK | Uniprot ID | Q8IYT8 |
Uniprot Id
Q8IYT8
Target Species
Human
Target Name
ULK2
Target Full Name
Serine/threonine-protein kinase ULK2
Target Function
Serine/threonine-protein kinase involved in autophagy in response to starvation. Acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and a negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. Activated via phosphorylation by AMPK, also acts as a negative regulator of AMPK through phosphorylation of the AMPK subunits PRKAA1, PRKAB2 and PRKAG1. May phosphorylate ATG13/KIAA0652, FRS2, FRS3 and RPTOR; however such data need additional evidences. Not involved in ammonia-induced autophagy or in autophagic response of cerebellar granule neurons (CGN) to low potassium concentration. Plays a role early in neuronal differentiation and is required for granule cell axon formation: may govern axon formation via Ras-like GTPase signaling and through regulation of the Rab5-mediated endocytic pathways within developing axons.
Target Subcellular Location
Cytoplasmic vesicle membrane; Peripheral membrane protein. Note=Localizes to pre-autophagosomal membrane.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, APG1/unc-51/ULK1 subfamily
Target Synonyms
ATG1B; KIAA0623; Serine/threonine protein kinase ULK2; Serine/threonine-protein kinase ULK2; ULK2; ULK2_HUMAN; Unc 51 (C. elegans) like kinase 2; Unc 51 like autophagy activating kinase 2; Unc 51 like kinase 2; Unc-51-like kinase 2; Unc51.2
Target Background
This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternatively spliced transcript variants encoding the same protein have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
