-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UNC5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human UNC5B (NP_734465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UNC5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human UNC5B (NP_734465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10152A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UNC5B |
| Target Synonyms | UNC5H2; p53RDL1; UNC5B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, A-549, Mouse brain, Mouse lung, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-377 of human UNC5B (NP_734465.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALY | Uniprot ID | Q8IZJ1 |
Uniprot Id
Q8IZJ1
Target Species
Human
Target Name
UNC5B
Target Full Name
Netrin receptor UNC5B
Target Function
Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. Functions as netrin receptor that negatively regulates vascular branching during angiogenesis. Mediates retraction of tip cell filopodia on endothelial growth cones in response to netrin. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Mediates apoptosis by activating DAPK1. In the absence of NTN1, activates DAPK1 by reducing its autoinhibitory phosphorylation at Ser-308 thereby increasing its catalytic activity.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Target Protein Families
Unc-5 family
Target Tissue Specificity
Highly expressed in brain. Also expressed at lower level in developing lung, cartilage, kidney and hematopoietic and immune tissues.
Target Synonyms
6330415E02Rik; A630020F16; D10Bwg0792e; Netrin receptor UNC5B; Netrin receptor UNC5B Precursor; p53 regulated receptor for death and life; p53 regulated receptor for death and life protein 1; p53-regulated receptor for death and life protein 1; p53RDL1; Protein unc-5 homolog 2; Protein unc-5 homolog B; Protein XUNC 5; Transmembrane receptor Unc5H2; Unc 5 homolog 2; Unc 5 homolog B; Unc 5 netrin receptor B; UNC 5B; Unc5 (C.elegans homolog) b; Unc5b; UNC5B_HUMAN; UNC5H2
Target Background
This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.
Notification