Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UPP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14443A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPP1 |
| Target Synonyms | UP; UPP; UPASE; UDRPASE; UPP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat heart, 293T, Mouse large intestine, Mouse lung, Rat large intestine, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV | Uniprot ID | Q16831 |
Uniprot Id
Q16831
Target Species
Human
Target Name
UPP1
Target Full Name
Uridine phosphorylase 1
Target Function
Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Target Protein Families
PNP/UDP phosphorylase family
Target Synonyms
UDRPASE; UP; UPase 1; UPASE; UPP; Upp1; UPP1_HUMAN; UrdPase 1; Uridine phosphorylase 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
