-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UQCC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UQCC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00829A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UQCC2 |
| Target Synonyms | M19; Cbp6; MNF1; MC3DN7; C6orf125; C6orf126; bA6B20.2; UQCC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, HepG2, MCF7, Mouse brain, Mouse testis, THP-1, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA | Uniprot ID | Q9BRT2 |
Uniprot Id
Q9BRT2
Target Species
Human
Target Name
UQCC2
Target Full Name
Ubiquinol-cytochrome c reductase complex assembly factor 2
Target Function
Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex). Plays a role in the modulation of respiratory chain activities such as oxygen consumption and ATP production and via its modulation of the respiratory chain activity can regulate skeletal muscle differentiation and insulin secretion by pancreatic beta-cells. Involved in cytochrome b translation and/or stability.
Target Involvement
Mitochondrial complex III deficiency, nuclear 7 (MC3DN7)
Target Subcellular Location
Mitochondrion matrix, mitochondrion nucleoid. Mitochondrion. Mitochondrion intermembrane space. Mitochondrion matrix. Mitochondrion inner membrane.
Target Tissue Specificity
Pancreas, skeletal muscle, kidney, liver and heart.
Target Synonyms
UQCC2; C6orf125; MNF1; Ubiquinol-cytochrome-c reductase complex assembly factor 2; Breast cancer-associated protein SGA-81M; Mitochondrial nucleoid factor 1; Mitochondrial protein M19
Target Background
This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.
Notification