-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UQCRQ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UQCRQ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08901A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UQCRQ |
| Target Synonyms | QPC; QCR8; QP-C; UQCR7; MC3DN4; UQCRQ | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK | Uniprot ID | O14949 |
Uniprot Id
O14949
Target Species
Human
Target Name
UQCRQ
Target Full Name
Cytochrome b-c1 complex subunit 8
Target Function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
Target Involvement
Mitochondrial complex III deficiency, nuclear 4 (MC3DN4)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
UQCRQ/QCR8 family
Target Research Area
Transport
Target Synonyms
Complex III subunit 8; Complex III subunit VIII; Cytochrome b-c1 complex subunit 8; QCR8; QCR8_HUMAN; QP-C; QPC; Ubiquinol-cytochrome c reductase complex 9.5 kDa protein; Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; Uqcrq
Target Background
This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
Notification