Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against URM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human URM1 (NP_001252511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against URM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human URM1 (NP_001252511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | URM1 |
| Target Synonyms | C9orf74; URM1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human URM1 (NP_001252511.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSV | Uniprot ID | Q9BTM9 |
Uniprot Id
Q9BTM9
Target Species
Human
Target Name
URM1
Target Full Name
Ubiquitin-related modifier 1
Target Function
Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.
Target Subcellular Location
Cytoplasm.
Target Protein Families
URM1 family
Target Synonyms
2900073H19Rik; C9orf74; Chromosome 9 open reading frame 74; MGC2668; RGD1306599; RP11 339B21.4; RP23-443G7.1; Ubiquitin related modifier 1; Ubiquitin related modifier 1 homolog; Ubiquitin-related modifier 1 homolog; Urm 1; URM1; URM1_HUMAN
Target Background
Enables sulfur carrier activity. Involved in tRNA thio-modification and tRNA wobble uridine modification. Predicted to be located in cytosol. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
