Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human USF2 (NP_003358.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human USF2 (NP_003358.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09134A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USF2 |
| Target Synonyms | FIP; bHLHb12; USF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human USF2 (NP_003358.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMM | Uniprot ID | Q15853 |
Uniprot Id
Q15853
Target Species
Human
Target Name
USF2
Target Full Name
Upstream stimulatory factor 2
Target Function
Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
bHLHb12; Class B basic helix-loop-helix protein 12; FIP; FOS interacting protein; FOS-interacting protein; Major late transcription factor 2; Upstream stimulatory factor 2; Upstream transcription factor 2; USF 2; Usf2; USF2_HUMAN
Target Background
This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
