-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human USP11 (NP_004642.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human USP11 (NP_004642.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07408A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP11 |
| Target Synonyms | UHX1; USP11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human USP11 (NP_004642.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQ | Uniprot ID | P51784 |
Uniprot Id
P51784
Target Species
Human
Target Name
USP11
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 11
Target Function
Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Cleaves preferentially 'Lys-6' and 'Lys-63'-linked ubiquitin chains. Has lower activity with 'Lys-11' and 'Lys-33'-linked ubiquitin chains, and extremely low activity with 'Lys-27', 'Lys-29' and 'Lys-48'-linked ubiquitin chains (in vitro). Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks. Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like complex.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome.
Target Protein Families
Peptidase C19 family
Target Synonyms
Deubiquitinating enzyme 11; Ubiquitin carboxyl-terminal hydrolase 11; Ubiquitin carboxyl-terminal hydrolase X linked; ubiquitin specific peptidase 11; Ubiquitin specific protease 11; Ubiquitin thiolesterase 11; Ubiquitin-specific-processing protease 11; UBP11_HUMAN; UHX1; USP11
Target Background
Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23
Notification