-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human USP36 (NP_079366.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human USP36 (NP_079366.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03441A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP36 |
| Target Synonyms | DUB1; USP36 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human USP36 (NP_079366.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKYVLLNPKTEGASRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV | Uniprot ID | Q9P275 |
Uniprot Id
Q9P275
Target Species
Human
Target Name
USP36
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 36
Target Function
Deubiquitinase essential for the regulation of nucleolar structure and function. Required for cell and organism viability. Plays an important role in ribosomal RNA processing and protein synthesis, which is mediated, at least in part, through deubiquitination of DHX33, NPM1 and FBL, regulating their protein stability. Functions as a transcriptional repressor by deubiquiting histone H2B at the promoters of genes critical for cellular differentiation, such as CDKN1A, thereby preventing histone H3 'Lys-4' trimethylation (H3K4). Specifically deubiquitinates MYC in the nucleolus, leading to prevent MYC degradation by the proteasome: acts by specifically interacting with isoform 3 of FBXW7 (FBW7gamma) in the nucleolus and counteracting ubiquitination of MYC by the SCF(FBW7) complex. In contrast, it does not interact with isoform 1 of FBXW7 (FBW7alpha) in the nucleoplasm. Interacts to and regulates the actions of E3 ubiquitin-protein ligase NEDD4L over substrates such as NTRK1, KCNQ2 and KCNQ3, affecting their expression an functions. Deubiquitinates SOD2, regulates SOD2 protein stability. Deubiquitinase activity is required to control selective autophagy activation by ubiquitinated proteins.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Broadly expressed.
Target Synonyms
Deubiquitinating enzyme 1; Deubiquitinating enzyme 36; DUB1; FLJ12851; KIAA1453; Ubiquitin carboxyl-terminal hydrolase 36; Ubiquitin specific peptidase 36; Ubiquitin specific processing protease 36; Ubiquitin thioesterase 36; Ubiquitin thiolesterase 36; Ubiquitin-specific-processing protease 36; UBP36_HUMAN; Usp36
Target Background
This gene encodes a member of the peptidase C19 or ubiquitin-specific protease family of cysteine proteases. Members of this family remove ubiquitin molecules from polyubiquitinated proteins. The encoded protein may deubiquitinate and stabilize the transcription factor c-Myc, also known as MYC, an important oncoprotein known to be upregulated in most human cancers. The encoded protease may also regulate the activation of autophagy. This gene exhibits elevated expression in some breast and lung cancers.
Notification