Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP37 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human USP37 (NP_065986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP37 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human USP37 (NP_065986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04947A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP37 |
| Target Synonyms | USP37 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, DU145, Mouse spleen, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human USP37 (NP_065986.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLETKDDIPFRKVLGNPGRGSIKTVAGSGIARTIPSLTSTSTPLRSGLLENRTEKRKRMISTGSELNEDYPKENDSSSNNKAMTDPSRKYLTSSREKQLSL | Uniprot ID | Q86T82 |
Uniprot Id
Q86T82
Target Species
Human
Target Name
USP37
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 37
Target Function
Deubiquitinase that antagonizes the anaphase-promoting complex (APC/C) during G1/S transition by mediating deubiquitination of cyclin-A (CCNA1 and CCNA2), thereby promoting S phase entry. Specifically mediates deubiquitination of 'Lys-11'-linked polyubiquitin chains, a specific ubiquitin-linkage type mediated by the APC/C complex. Also mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains in vitro. Phosphorylation at Ser-628 during G1/S phase maximizes the deubiquitinase activity, leading to prevent degradation of cyclin-A (CCNA1 and CCNA2). Plays an important role in the regulation of DNA replication by stabilizing the licensing factor CDT1.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Expressed in brain and prostate.
Target Synonyms
Deubiquitinating enzyme 3; Deubiquitinating enzyme 37; EC 3.1.2.15; KIAA1594; MGC117261; OTTHUMP00000164146; tmp_locus_50; Ubiquitin carboxyl-terminal hydrolase 37; Ubiquitin specific peptidase 37; Ubiquitin specific processing protease 37; Ubiquitin specific protease 37; Ubiquitin thioesterase 37; Ubiquitin thiolesterase 37; Ubiquitin-specific-processing protease 37; UBP37_HUMAN; USP37
Target Background
Enables cysteine-type endopeptidase activity; protein kinase binding activity; and thiol-dependent deubiquitinase. Involved in G1/S transition of mitotic cell cycle; protein deubiquitination; and regulation of DNA replication. Located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
