-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human USP44 (NP_115523.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human USP44 (NP_115523.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04990A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP44 |
| Target Synonyms | USP44 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Jurkat, Mouse liver, Mouse lung, Mouse pancreas, Raji, Rat kidney, Rat stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human USP44 (NP_115523.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTLSAIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVVKREVKKRRQELEYQVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKDKVLSTSENEISQKVSDSSVKRRPIVTP | Uniprot ID | Q9H0E7 |
Uniprot Id
Q9H0E7
Target Species
Human
Target Name
USP44
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 44
Target Function
Deubiquitinase that plays a key regulatory role in the spindle assembly checkpoint or mitotic checkpoint by preventing premature anaphase onset. Acts by specifically mediating deubiquitination of CDC20, a negative regulator of the anaphase promoting complex/cyclosome (APC/C). Deubiquitination of CDC20 leads to stabilize the MAD2L1-CDC20-APC/C ternary complex (also named mitotic checkpoint complex), thereby preventing premature activation of the APC/C. Promotes association of MAD2L1 with CDC20 and reinforces the spindle assembly checkpoint. Acts as a negative regulator of histone H2B (H2BK120ub1) ubiquitination.
Target Subcellular Location
Nucleus.
Target Protein Families
Peptidase C19 family, USP44 subfamily
Target Tissue Specificity
Expressed in testis. Expressed at high levels in T-cell acute lymphoblastic leukemia.
Target Synonyms
Deubiquitinating enzyme 44; E430004F17Rik; Ubiquitin carboxyl-terminal hydrolase 44; ubiquitin specific peptidase 44; Ubiquitin thiolesterase 44; Ubiquitin-specific-processing protease 44; UBP44_HUMAN; USP44
Target Background
The protein encoded by this gene is a protease that functions as a deubiquitinating enzyme. The encoded protein is thought to help regulate the spindle assembly checkpoint by preventing early anaphase onset. This protein specifically deubiquitinates CDC20, which stabilizes the anaphase promoting complex/cyclosome.
Notification