Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP46 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human USP46 (NP_073743.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP46 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human USP46 (NP_073743.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10480A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP46 |
| Target Synonyms | USP46 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human USP46 (NP_073743.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSV | Uniprot ID | P62068 |
Uniprot Id
P62068
Target Species
Human
Target Name
USP46
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 46
Target Function
Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.
Target Protein Families
Peptidase C19 family, USP12/USP46 subfamily
Target Tissue Specificity
Broadly expressed.
Target Synonyms
Deubiquitinating enzyme 46; FLJ11850; FLJ12552; FLJ14283; FLJ39393; Ubiquitin carboxyl terminal hydrolase 46; Ubiquitin carboxyl-terminal hydrolase 46; Ubiquitin specific peptidase 46; Ubiquitin specific processing protease 46; Ubiquitin specific protease 46; Ubiquitin thioesterase 46; Ubiquitin thiolesterase 46; Ubiquitin-specific-processing protease 46; UBP46_HUMAN; USP46
Target Background
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
