Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP53 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 495-582 of human USP53(NP_061923.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP53 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 495-582 of human USP53(NP_061923.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP53 |
| Target Synonyms | USP53; ubiquitin specific peptidase 53 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse placenta | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 495-582 of human USP53(NP_061923.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNR | Uniprot ID | Q70EK8 |
Uniprot Id
Q70EK8
Target Species
Human
Target Name
USP53
Target Full Name
Inactive ubiquitin carboxyl-terminal hydrolase 53
Target Function
Tight junction-associated protein that is involved in the survival of auditory hair cells and hearing. Maybe by modulating the barrier properties and mechanical stability of tight junctions. Has no peptidase activity.
Target Subcellular Location
Cell junction, tight junction.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Expressed predominantly in skeletal muscle and heart.
Target Synonyms
USP53; KIAA1350; Inactive ubiquitin carboxyl-terminal hydrolase 53; Inactive ubiquitin-specific peptidase 53
Target Background
Predicted to enable thiol-dependent deubiquitinase. Predicted to be involved in response to auditory stimulus and sensory perception of sound. Predicted to act upstream of or within action potential and neuron apoptotic process. Predicted to be located in bicellular tight junction. Predicted to be active in cell-cell junction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
