-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP9X was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (Q93008) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against USP9X was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (Q93008) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16221A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP9X |
| Target Synonyms | FAF; FAM; hFAM; DFFRX; MRX99; XLID99; MRXS99F; USP9X | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, 293T, Mouse brain, Mouse testis, U-251 MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (Q93008). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA | Uniprot ID | Q93008 |
Uniprot Id
Q93008
Target Species
Human
Target Name
USP9X
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 9X
Target Function
Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Specifically hydrolyzes 'Lys-48'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitins chains. Essential component of TGF-beta/BMP signaling cascade. Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Deubiquitinates alkylation repair enzyme ALKBH3. OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions. Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres. Involved in axonal growth and neuronal cell migration. Regulates cellular clock function by enhancing the protein stability and transcriptional activity of the core circadian protein ARNTL/BMAL1 via its deubiquitinating activity.
Target Involvement
Mental retardation, X-linked 99 (MRX99)
Target Subcellular Location
Cytoplasm. Cell projection, growth cone.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Widely expressed in embryonic and adult tissues.
Target Synonyms
Deubiquitinating enzyme FAF X; Deubiquitinating enzyme FAF-X; DFFRX; Drosophila fat facets related X linked; FAF; Fafl; Fam; Fat facets homolog; Fat facets in mammals; Fat facets protein related X linked; Fat facets protein related, X-linked; Fat facets protein-related; hFAM; MRX99; Probable ubiquitin carboxyl terminal hydrolase FAF X; Probable ubiquitin carboxyl-terminal hydrolase FAF-X; Ubiquitin carboxyl-terminal hydrolase FAM; Ubiquitin specific peptidase 9 X linked; Ubiquitin specific peptidase 9, X-linked; Ubiquitin specific processing protease FAF X; Ubiquitin specific protease 9 X chromosome; Ubiquitin thioesterase FAF X; Ubiquitin thiolesterase FAF X; Ubiquitin thiolesterase FAF-X; Ubiquitin-specific protease 9; Ubiquitin-specific-processing protease FAF-X; USP9 (gene name); Usp9x; USP9X_HUMAN; Uubiquitin specific protease 9, X chromosome (fat facets like Drosophila); X chromosome; X-linked
Target Background
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification