-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human VAMP1 (P23763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against VAMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human VAMP1 (P23763) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14174A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAMP1 |
| Target Synonyms | SAX1; SYB1; CMS25; SPAX1; VAMP-1; VAMP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human VAMP1 (P23763). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT | Uniprot ID | P23763 |
Uniprot Id
P23763
Target Species
Human
Target Name
VAMP1
Target Full Name
Vesicle-associated membrane protein 1
Target Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Target Involvement
Spastic ataxia 1, autosomal dominant (SPAX1)
Target Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.; [Isoform 2]: Cytoplasmic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.; [Isoform 3]: Mitochondrion outer membrane; Single-pass type IV membrane protein.
Target Protein Families
Synaptobrevin family
Target Tissue Specificity
Nervous system, skeletal muscle and adipose tissue.
Target Synonyms
VAMP1; SYB1; Vesicle-associated membrane protein 1; VAMP-1; Synaptobrevin-1
Target Background
Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined.
Notification