Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAMP3/Cellubrevin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VAMP3/Cellubrevin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02497A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAMP3/Cellubrevin |
| Target Synonyms | CEB; VAMP3/Cellubrevin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, A-549, Mouse lung, Mouse testis, SKOV3, SW480, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWA | Uniprot ID | Q15836 |
Uniprot Id
Q15836
Target Species
Human
Target Name
VAMP3
Target Full Name
Vesicle-associated membrane protein 3
Target Function
SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Target Subcellular Location
Membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.
Target Protein Families
Synaptobrevin family
Target Synonyms
CEB; Cellubrevin; Synaptobrevin 3; Synaptobrevin-3; VAMP 3; VAMP-3; VAMP3; VAMP3_HUMAN; Vesicle associated membrane protein 3; Vesicle-associated membrane protein 3
Target Background
Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Because of its high homology to other known VAMPs, its broad tissue distribution, and its subcellular localization, the protein encoded by this gene was shown to be the human equivalent of the rodent cellubrevin. In platelets the protein resides on a compartment that is not mobilized to the plasma membrane on calcium or thrombin stimulation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
