-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAMP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-121 of human VAMP7 (P51809) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VAMP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-121 of human VAMP7 (P51809) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10587A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAMP7 |
| Target Synonyms | SYBL1; TIVAMP; VAMP-7; TI-VAMP; VAMP7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-1080, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-121 of human VAMP7 (P51809). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK | Uniprot ID | P51809 |
Uniprot Id
P51809
Target Species
Human
Target Name
VAMP7
Target Full Name
Vesicle-associated membrane protein 7
Target Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle membrane; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Late endosome membrane; Single-pass type IV membrane protein. Lysosome membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Cytoplasmic vesicle, phagosome membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.
Target Protein Families
Synaptobrevin family
Target Tissue Specificity
Detected in all tissues tested.
Target Research Area
Cell Cycle
Target Synonyms
FLJ53045; FLJ53762; FLJ54296; HGNC:11486; OTTHUMP00000024258; OTTHUMP00000024259; OTTHUMP00000225953; SYBL 1; SYBL1; Synaptobrevin like 1; Synaptobrevin-like protein 1; Tetanus insensitive VAMP; Tetanus neurotoxin insensitive VAMP; Tetanus-insensitive VAMP; TI VAMP; Ti-VAMP; TIVAMP; VAMP-7; VAMP7; VAMP7_HUMAN; Vesicle-associated membrane protein 7
Target Background
This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.
Notification