Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAPA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 137-227 of human VAPA (NP_919415.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VAPA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 137-227 of human VAPA (NP_919415.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09561A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAPA |
| Target Synonyms | VAP-A; VAP33; VAMP-A; VAP-33; hVAP-33; VAPA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, B-cell, Mouse pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 137-227 of human VAPA (NP_919415.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP | Uniprot ID | Q9P0L0 |
Uniprot Id
Q9P0L0
Target Species
Human
Target Name
VAPA
Target Full Name
Vesicle-associated membrane protein-associated protein A
Target Function
Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites. The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface. With OSBPL3, may regulate ER morphology. May play a role in vesicle trafficking.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Cell membrane; Single-pass type IV membrane protein. Cell junction, tight junction. Nucleus membrane.
Target Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
33 kDa Vamp-associated protein; hVAP 33; MGC3745; OTTHUMP00000162362; OTTHUMP00000162363; VAMP (vesicle-associated membrane protein) associated protein A, 33kDa; VAMP A; VAMP associated protein A; VAMP-A; VAMP-associated protein A; VAP 33; VAP A; VAP-33; VAP-A; VAP33; Vapa; VAPA_HUMAN; Vesicle associated membrane protein associated protein A; Vesicle-associated membrane protein-associated protein A
Target Background
The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
