Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 864-1063 of human VARS2 (NP_065175.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 864-1063 of human VARS2 (NP_065175.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05023A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VARS2 |
| Target Synonyms | VALRS; VARSL; VARS2L; COXPD20; VARS2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 864-1063 of human VARS2 (NP_065175.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LWQRLPPRPGCPPAPSISVAPYPSACSLEHWRQPELERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEPLGTLGYCGAVGLLPPGAAAPSGWAQAPLSDTAQVYMELQGLVDPQIQLPLLAARRYKLQKQLDSLTARTPSEGEAGTQRQQKLSSLQLELSKLDKAASHLRQLMDEPPAPGSPEL | Uniprot ID | Q5ST30 |
Uniprot Id
Q5ST30
Target Species
Human
Target Name
VARS2
Target Full Name
Valine--tRNA ligase, mitochondrial
Target Involvement
Combined oxidative phosphorylation deficiency 20 (COXPD20)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family
Target Synonyms
COXPD20; mitochondrial; SYVM_HUMAN; Valine--tRNA ligase; ValRS; Valyl tRNA synthetase 2 mitochondrial; Valyl-tRNA synthetase; Valyl-tRNA synthetase-like; Vars2; VARS2L; VARSL
Target Background
This gene encodes a mitochondrial aminoacyl-tRNA synthetase, which catalyzes the attachment of valine to tRNA(Val) for mitochondrial translation. Mutations in this gene cause combined oxidative phosphorylation deficiency-20, and are also associated with early-onset mitochondrial encephalopathies. Alternative splicing of this gene results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
