-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VDAC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC1 (P21796) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against VDAC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC1 (P21796) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17129A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VDAC1 |
| Target Synonyms | PORIN; VDAC-1; VDAC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Rat heart, 293T, HepG2, Mouse liver, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC1 (P21796). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD | Uniprot ID | P21796 |
Uniprot Id
P21796
Target Species
Human
Target Name
VDAC1
Target Full Name
Non-selective voltage-gated ion channel VDAC1
Target Function
Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Binds various signaling molecules, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterol cholesterol. In depolarized mitochondria, acts downstream of PRKN and PINK1 to promote mitophagy or prevent apoptosis; polyubiquitination by PRKN promotes mitophagy, while monoubiquitination by PRKN decreases mitochondrial calcium influx which ultimately inhibits apoptosis. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. May mediate ATP export from cells.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.
Target Protein Families
Eukaryotic mitochondrial porin family
Target Tissue Specificity
Expressed in erythrocytes (at protein level). Expressed in heart, liver and skeletal muscle.
Target Synonyms
N2441; OMP2; POR1; hVDAC1; MGC111064; Mitochondrial Porin; Outer mitochondrial membrane protein porin 1; Plasmalemmal porin; Porin 31HL; Porin 31HM; VDAC; VDAC-1; Vdac1; VDAC1_HUMAN; Voltage dependent anion channel 1; Voltage dependent anion selective channel protein 1; Voltage-dependent anion-selective channel protein 1; YNL055C; YNL2441C
Target Background
This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.
Notification