Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VDAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VDAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14613A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VDAC2 |
| Target Synonyms | POR; VDAC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, Mouse brain, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIED | Uniprot ID | P45880 |
Uniprot Id
P45880
Target Species
Human
Target Name
VDAC2
Target Full Name
Non-selective voltage-gated ion channel VDAC2
Target Function
Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterol cholesterol. Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway.
Target Subcellular Location
Mitochondrion outer membrane. Membrane.
Target Protein Families
Eukaryotic mitochondrial porin family
Target Tissue Specificity
Expressed in erythrocytes (at protein level). Expressed in all tissues examined.
Target Synonyms
B-36 vdac; FLJ23841; hVDAC2; OTTHUMP00000019878; OTTHUMP00000019879; OTTHUMP00000019880; Outer mitochondrial membrane protein porin 2; POR; Porin-2; VDAC 2; VDAC-2; VDAC2; VDAC2_HUMAN; Vdac6; Voltage dependent anion channel 2; Voltage dependent anion selective channel protein 2; Voltage-dependent anion-selective channel protein 2
Target Background
This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
