-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VE Cadherin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human VE Cadherin (NP_001786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VE Cadherin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human VE Cadherin (NP_001786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12880A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VE Cadherin |
| Target Synonyms | 7B4; CD144; VE Cadherin | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HUVEC, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human VE Cadherin (NP_001786.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQ | Uniprot ID | P33151 |
Uniprot Id
P33151
Target Species
Human
Target Name
CDH5
Target Full Name
Cadherin-5
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton. Acts in concert with KRIT1 and PALS1 to establish and maintain correct endothelial cell polarity and vascular lumen. These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction.
Target Subcellular Location
Cell junction. Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Endothelial tissues and brain.
Target Synonyms
CDH5; Cadherin-5; 7B4 antigen; Vascular endothelial cadherin; VE-cadherin; CD antigen CD144
Target Background
This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.
Notification