-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VEGFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-121 of human VEGFB (NP_003368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VEGFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-121 of human VEGFB (NP_003368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00526A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VEGFB |
| Target Synonyms | VRF; VEGFL; VEGFB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-121 of human VEGFB (NP_003368.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ | Uniprot ID | P49765 |
Uniprot Id
P49765
Target Species
Human
Target Name
VEGFB
Target Full Name
Vascular endothelial growth factor B
Target Function
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
Target Subcellular Location
Secreted. Note=Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
Target Protein Families
PDGF/VEGF growth factor family
Target Tissue Specificity
Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
Target Research Area
Cancer
Target Synonyms
Vascular endothelial growth factor B; Vascular endothelial growth factor-related factor; VEGF B; VEGF related factor; VEGF-B; VEGF-related factor; Vegfb; VEGFB_HUMAN; VEGFL; VRF
Target Background
This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
Notification