Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02544A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VIP |
| Target Synonyms | PHM27; VIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spinal cord | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK | Uniprot ID | P01282 |
Uniprot Id
P01282
Target Species
Human
Target Name
VIP
Target Full Name
VIP peptides
Target Function
VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; PHM and PHV also cause vasodilation. PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin.
Target Subcellular Location
Secreted.
Target Protein Families
Glucagon family
Target Synonyms
Peptide histidine methioninamide 27; Peptide histidine valine 42; PHM27; PHV42; Prepro VIP; Vasoactive intestinal peptide; Vasoactive intestinal polypeptide; VIP; VIP peptides; VIP peptides precursor; VIP_HUMAN
Target Background
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
