-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VIPR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human VIPR1 (NP_004615.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VIPR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human VIPR1 (NP_004615.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01610A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VIPR1 |
| Target Synonyms | II; HVR1; RDC1; V1RG; VIPR; VIRG; VAPC1; VPAC1; VPAC1R; VIP-R-1; VPCAP1R; PACAP-R2; PACAP-R-2; VIPR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human VIPR1 (NP_004615.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY | Uniprot ID | P32241 |
Uniprot Id
P32241
Target Species
Human
Target Name
VIPR1
Target Full Name
Vasoactive intestinal polypeptide receptor 1
Target Function
This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Tissue Specificity
In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Pe
Target Synonyms
VIPR1; Vasoactive intestinal polypeptide receptor 1; VIP-R-1; Pituitary adenylate cyclase-activating polypeptide type II receptor; PACAP type II receptor; PACAP-R-2; PACAP-R2; VPAC1
Target Background
This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene.
Notification