-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Vitamin D Binding protein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 305-474 of human Vitamin D Binding protein (NP_000574.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Vitamin D Binding protein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 305-474 of human Vitamin D Binding protein (NP_000574.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14693A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Vitamin D Binding protein |
| Target Synonyms | DBP; VDB; GRD3; VDBG; VDBP; GcMAF; DBP/GC; Gc-MAF; DBP-maf; HEL-S-51; Vitamin D Binding protein | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat plasma | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 305-474 of human Vitamin D Binding protein (NP_000574.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL | Uniprot ID | P02774 |
Uniprot Id
P02774
Target Species
Human
Target Name
GC
Target Full Name
Vitamin D-binding protein
Target Function
Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Target Subcellular Location
Secreted.
Target Protein Families
ALB/AFP/VDB family
Target Tissue Specificity
Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine.
Target Research Area
Signal Transduction, Transport
Target Synonyms
DBP; DBP/GC; GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB; VDBG; VDBP; Vitamin D binding alpha globulin; Vitamin D-binding protein; VTDB_HUMAN
Target Background
The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification