-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Vitronectin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-478 of human Vitronectin (NP_000629.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Vitronectin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 399-478 of human Vitronectin (NP_000629.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06177A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Vitronectin |
| Target Synonyms | VN; V75; VNT; Vitronectin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 399-478 of human Vitronectin (NP_000629.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL | Uniprot ID | P04004 |
Uniprot Id
P04004
Target Species
Human
Target Name
VTN
Target Full Name
Vitronectin
Target Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.; Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.
Target Subcellular Location
Secreted, extracellular space.; Parasitophorous vacuole.
Target Tissue Specificity
Expressed in the retina pigment epithelium (at protein level). Expressed in plasma (at protein level). Expressed in serum (at protein level).
Target Research Area
Cardiovascular
Target Synonyms
Complement S Protein; Epibolin; S Protein; S-protein; Serum Spreading Factor; Serum-spreading factor; Somatomedin B; Somatomedin-B; V75; Vitronectin; Vitronectin V10 subunit; Vitronectin V65 subunit; VN; VNT; VTN; VTNC_HUMAN
Target Background
The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein.
Notification