-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS11 (Q9H270) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VPS11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS11 (Q9H270) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13270A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS11 |
| Target Synonyms | END1; PEP5; HLD12; RNF108; hVPS11; DYT32; VPS11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Mouse brain, Mouse testis, Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS11 (Q9H270). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILA | Uniprot ID | Q9H270 |
Uniprot Id
Q9H270
Target Species
Human
Target Name
VPS11
Target Full Name
Vacuolar protein sorting-associated protein 11 homolog
Target Function
Plays a role in vesicle-mediated protein trafficking to lysosomal compartments including the endocytic membrane transport and autophagic pathways. Believed to act as a core component of the putative HOPS and CORVET endosomal tethering complexes which are proposed to be involved in the Rab5-to-Rab7 endosome conversion probably implicating MON1A/B, and via binding SNAREs and SNARE complexes to mediate tethering and docking events during SNARE-mediated membrane fusion. The HOPS complex is proposed to be recruited to Rab7 on the late endosomal membrane and to regulate late endocytic, phagocytic and autophagic traffic towards lysosomes. The CORVET complex is proposed to function as a Rab5 effector to mediate early endosome fusion probably in specific endosome subpopulations. Required for fusion of endosomes and autophagosomes with lysosomes. Involved in cargo transport from early to late endosomes and required for the transition from early to late endosomes. Involved in the retrograde Shiga toxin transport.
Target Involvement
Leukodystrophy, hypomyelinating, 12 (HLD12)
Target Subcellular Location
Endosome. Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Early endosome. Cytoplasmic vesicle. Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle, clathrin-coated vesicle.
Target Protein Families
VPS11 family
Target Tissue Specificity
Ubiquitous. Expression was highest in heart and low in lung.
Target Synonyms
END1; HGNC:14583; hVPS11; PEP5; PP3476; RING finger protein 108; RNF108; Vacuolar protein sorting 11 (yeast homolog); Vacuolar protein sorting 11 (yeast); Vacuolar protein sorting 11 homolog (S. cerevisiae); Vacuolar protein sorting 11 homolog; Vacuolar protein sorting associated protein 11 homolog; Vacuolar protein sorting protein 11; Vacuolar protein sorting-associated protein 11 homolog; vps11; VPS11_HUMAN
Target Background
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Alternative splicing results in multiple transcript variants.
Notification