-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against VPS25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03453A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS25 |
| Target Synonyms | DERP9; EAP20; FAP20; VPS25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, BxPC-3, Mouse brain, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human VPS25 (NP_115729.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF | Uniprot ID | Q9BRG1 |
Uniprot Id
Q9BRG1
Target Species
Human
Target Name
VPS25
Target Full Name
Vacuolar protein-sorting-associated protein 25
Target Function
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. The ESCRT-II complex may be involved in facilitating the budding of certain RNA viruses.
Target Subcellular Location
Cytoplasm. Endosome membrane. Nucleus, nucleoplasm. Note=Distributes diffusely throughout the cytoplasm and nucleoplasm, but exhibits a punctate distribution on coexpression with CHMP6.
Target Protein Families
VPS25 family
Target Tissue Specificity
Expressed at the mRNA level in kidney, liver, pancreas, and placenta. Lower levels of expression are found in heart, skeletal muscle, brain and lung.
Target Synonyms
Dermal papilla derived protein 9; Dermal papilla-derived protein 9; DERP9; EAP20; ELL associated protein of 20 kDa; ELL-associated protein of 20 kDa; ESCRT-II complex subunit VPS25; FAP20; HGNC:28122; hVps25; MGC10540; Vacuolar protein sorting 25 homolog (S. cerevisiae); Vacuolar protein sorting associated protein 25; Vacuolar protein-sorting-associated protein 25; VPS25; VPS25_HUMAN
Target Background
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1.
Notification