-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human VRK1 (NP_003375.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human VRK1 (NP_003375.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13726A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VRK1 |
| Target Synonyms | PCH1; PCH1A; K1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human VRK1 (NP_003375.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK | Uniprot ID | Q99986 |
Uniprot Id
Q99986
Target Species
Human
Target Name
VRK1
Target Full Name
Serine/threonine-protein kinase VRK1
Target Function
Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.
Target Involvement
Pontocerebellar hypoplasia 1A (PCH1A)
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle. Note=Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.
Target Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily
Target Tissue Specificity
Widely expressed. Highly expressed in fetal liver, testis and thymus.
Target Synonyms
MGC117401; MGC138280; MGC142070; PCH1; PCH1A; Serine/threonine protein kinase VRK1; Serine/threonine-protein kinase VRK1; Vaccinia related kinase 1; Vaccinia virus B1R related kinase 1; Vaccinia-related kinase 1; VRK1; VRK1_HUMAN
Target Background
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.
Notification