Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VRK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-412 of human VRK3 (NP_001295349) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VRK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-412 of human VRK3 (NP_001295349) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01872A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VRK3 |
| Form | Liquid | Species Reactivity | Human |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | HepG2 |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 266-412 of human VRK3 (NP_001295349). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKLPWDSF | Uniprot ID | Q8IV63 |
Uniprot Id
Q8IV63
Target Species
Human
Target Name
VRK3
Target Full Name
Serine/threonine-protein kinase VRK3
Target Function
Inactive kinase that suppresses ERK activity by promoting phosphatase activity of DUSP3 which specifically dephosphorylates and inactivates ERK in the nucleus.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily
Target Synonyms
Inactive serine/threonine-protein kinase VRK3; Serine/threonine protein kinase VRK3; Serine/threonine-protein pseudokinase VRK3; Vaccinia related kinase 3; Vaccinia-related kinase 3; Vrk3; VRK3_HUMAN
Target Background
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. In both human and mouse, this gene has substitutions at several residues within the ATP binding motifs that in other kinases have been shown to be required for catalysis. In vitro assays indicate the protein lacks phosphorylation activity. The protein, however, likely retains its substrate binding capability. This gene is widely expressed in human tissues and its protein localizes to the nucleus. Alternative splicing results in multiple transcripts encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
