Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VSIG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human VSIG1 (NP_872413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VSIG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human VSIG1 (NP_872413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05974A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VSIG1 |
| Target Synonyms | GPA34; dJ889N15.1; 1700062D20Rik; VSIG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxP-C3, Mouse pancreas, Mouse stomach, Mouse testis, OVCAR3, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human VSIG1 (NP_872413.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSH | Uniprot ID | Q86XK7 |
Uniprot Id
Q86XK7
Target Species
Human
Target Name
VSIG1
Target Full Name
V-set and immunoglobulin domain-containing protein 1
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%).
Target Research Area
Immunology
Target Synonyms
1700062D20Rik; Cell surface A33 antigen; ChT1 thymocyte antigen; dJ889N15.1; Glycoprotein A34; GPA34; MGC44287; OTTHUMP00000023820; V set and immunoglobulin domain containing; V-set and immunoglobulin domain containing 1; V-set and immunoglobulin domain-containing protein 1; VSIG1; VSIG1_HUMAN
Target Background
This gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multiple glycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP) repeats at the C-terminal region. The gene is expressed in normal stomach and testis, as well as in gastric, esophageal and ovarian cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
