-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WAVE2/WASF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WAVE2/WASF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16235A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WAVE2/WASF2 |
| Target Synonyms | IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; WAVE2/WASF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, K-562, Mouse testis, Mouse thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD | Uniprot ID | Q9Y6W5 |
Uniprot Id
Q9Y6W5
Target Species
Human
Target Name
WASF2
Target Full Name
Actin-binding protein WASF2
Target Function
Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Basolateral cell membrane.
Target Protein Families
SCAR/WAVE family
Target Tissue Specificity
Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle.
Target Synonyms
DICTYOSTELIUM; dJ393P12.2; IMD2; Protein WAVE-2; Putative Wiskott Aldrich syndrome protein family member 4; SCAR 2; SCAR; SCAR2; Suppressor of cyclic-AMP receptor (WASP family); Verprolin homology domain-containing protein 2; WASF2; WASF2_HUMAN; WASF4; WASP family protein member 2; WASP family protein member 4; WASP family Verprolin homologous protein 2; WASP-family protein member 2; WAVE 2; WAVE2; Wiskott-Aldrich syndrome protein family member 2; Wiskott-Aldrich syndrome protein family verprolin-homologous protein
Target Background
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene.
Notification