Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of human WBP1 (NP_036609.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of human WBP1 (NP_036609.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03521A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WBP1 |
| Target Synonyms | WBP-1; WBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of human WBP1 (NP_036609.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP | Uniprot ID | Q96G27 |
Uniprot Id
Q96G27
Target Species
Human
Target Name
WBP1
Target Full Name
WW domain-binding protein 1
Target Synonyms
WBP1; WW domain-binding protein 1; WBP-1
Target Background
The globular WW domain, named for the conserved tryptophan residues in the protein motif present in various structural and regulatory proteins, is known to play a role in the mediation of protein-protein interactions. This gene encodes a ligand of the WW domain of the Yes kinase-associated protein. Readthrough transcription of the neighboring upstream gene, which encodes INO80 complex subunit B, into this gene generates a non-coding transcript.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
