-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WBP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-641 of human WBP11 (NP_057396.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against WBP11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-641 of human WBP11 (NP_057396.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WBP11 |
| Target Synonyms | BUG13; FAP90; NPWBP; SIPP1; VCTRL; CFAP90; VCTERL; WBP-11; PPP1R165; WBP11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, RD | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-641 of human WBP11 (NP_057396.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL | Uniprot ID | Q9Y2W2 |
Uniprot Id
Q9Y2W2
Target Species
Human
Target Name
WBP11
Target Full Name
WW domain-binding protein 11
Target Function
Activates pre-mRNA splicing. May inhibit PP1 phosphatase activity.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Predominantly located in the nucleus with granular heterogeneous distribution. Excluded from nucleoli in interphase cells, distributed throughout cytoplasm in dividing cells. Colocalized with SC35 and U2B in the nucleus. In the cytoplasm, associates with the intermediate filament protein vimentin.
Target Tissue Specificity
Ubiquitous. Highly expressed in the heart, pancreas, kidney skeletal muscle, placenta and brain (at protein level). Weakly expressed in liver and lung.
Target Synonyms
DKFZp779M1063; MGC94547; Npw38 binding protein; Npw38 binding protein NpwBP; Npw38-binding protein; NpwBP; PPP1R165; Protein phosphatase 1 regulatory subunit 165; SH3 domain binding protein SNP70; SH3 domain-binding protein SNP70; SIPP1; SNP70; Splicing factor PQBP1 and PP1 interacting; Splicing factor that interacts with PQBP 1 and PP1; Splicing factor that interacts with PQBP-1 and PP1; WBP 11; WBP-11; Wbp11; WBP11_HUMAN; WW domain binding protein 11; WW domain-binding protein 11
Target Background
This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.
Notification