Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDFY4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human WDFY4 (NP_065996.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WDFY4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human WDFY4 (NP_065996.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03881A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDFY4 |
| Target Synonyms | C10orf64; WDFY4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human WDFY4 (NP_065996.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAEDLSKAEDRNEDPGSKNEGQLAAVQPDVPHGGQSSSPTALWDMLERKFLEYQQLTHKSPIERQKSLLSLLPLFLKAWEHSVGIICFPSLQRLAEDVSDQLAQQLQKALVGKPAEQARLAAGQLLWWKGDVDQDGYLLLKSVYVLTGTDSETLGRVAE | Uniprot ID | Q6ZS81 |
Uniprot Id
Q6ZS81
Target Species
Human
Target Name
WDFY4
Target Full Name
WD repeat- and FYVE domain-containing protein 4
Target Function
Plays a critical role in the regulation of cDC1-mediated cross-presentation of viral and tumor antigens in dendritic cells. Mechanistically, acts near the plasma membrane and interacts with endosomal membranes to promote endosomal-to-cytosol antigen trafficking. Plays also a role in B-cell survival through regulation of autophagy.
Target Subcellular Location
Early endosome. Endoplasmic reticulum.
Target Synonyms
WDFY4; C10orf64; KIAA1607WD repeat- and FYVE domain-containing protein 4
Target Background
Predicted to be involved in autophagy. Predicted to act upstream of or within with a positive effect on CD8-positive, alpha-beta T cell activation. Predicted to act upstream of or within antigen processing and presentation and cellular response to virus. Predicted to be located in early endosome and endoplasmic reticulum.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
