-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-148 of human WDR45 (NP_001025067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WDR45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-148 of human WDR45 (NP_001025067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02421A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR45 |
| Target Synonyms | JM5; NBIA4; NBIA5; WDRX1; WIPI4; WIPI-4; WDR45 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-148 of human WDR45 (NP_001025067.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLC | Uniprot ID | Q9Y484 |
Uniprot Id
Q9Y484
Target Species
Human
Target Name
WDR45
Target Full Name
WD repeat domain phosphoinositide-interacting protein 4
Target Function
Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation. Binds phosphatidylinositol 3-phosphate (PtdIns3P). Activated by the STK11/AMPK signaling pathway upon starvation, WDR45 is involved in autophagosome assembly downstream of WIPI2, regulating the size of forming autophagosomes. Together with WIPI1, promotes ATG2 (ATG2A or ATG2B)-mediated lipid transfer by enhancing ATG2-association with phosphatidylinositol 3-monophosphate (PI3P)-containing membranes. Probably recruited to membranes through its PtdIns3P activity.
Target Involvement
Neurodegeneration with brain iron accumulation 5 (NBIA5)
Target Subcellular Location
Preautophagosomal structure. Cytoplasm.
Target Protein Families
WD repeat SVP1 family
Target Tissue Specificity
Ubiquitously expressed, with high expression in skeletal muscle and heart. Weakly expressed in liver and placenta. Expression is down-regulated in pancreatic and in kidney tumors.
Target Research Area
Cell Biology
Target Synonyms
WDR45; WDRX1; WDRXI4; WIPI4; JM5; WD repeat domain phosphoinositide-interacting protein 4; WIPI-4; WD repeat-containing protein 45
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene has a pseudogene at chromosome 4q31.3. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity and full-length nature of some variants have not been determined.
Notification